Skip to main content
    ChemVerify
    Peptide Comparisons

    Mounjaro (Tirzepatide): Chemical Profile, Structure & Research Overview

    Comprehensive chemical profile of Mounjaro (tirzepatide), the dual GIP/GLP-1 receptor agonist. MW 4,813.52 Da, 39-amino acid linear peptide with C20 fatty diacid modification.

    ChemVerify Research Team
    14 min read
    Published March 26, 2026
    Mounjaro (Tirzepatide): Chemical Profile, Structure & Research Overview – featured illustration

    For laboratory research use only. Not for human consumption.

    Last verified: March 2026 | Data accuracy confirmed by ChemVerify Editorial Team

    TL;DR: Tirzepatide (brand name Mounjaro, Eli Lilly) is a 39-amino acid linear peptide (MW 4,813.52 Da, C225H348N48O68) that acts as a dual GIP/GLP-1 receptor agonist. It features a C20 fatty diacid moiety linked via a PEG spacer at Lys20. Distinguished from semaglutide by its dual-receptor activity and ~700 Da higher molecular weight. Research-grade material requires ≥95% HPLC purity with intact mass confirmation.

    Chemical Structure & Molecular Properties

    Tirzepatide is a 39-amino acid synthetic peptide with a molecular weight of 4,813.52 Da and the molecular formula C225H348N48O68. Its sequence is based on native GIP with engineered GLP-1 receptor cross-reactivity. The peptide contains an alpha-aminoisobutyric acid (Aib) residue at position 2 for DPP-IV resistance, and a C20 fatty diacid (eicosanedioic acid) conjugated to Lys20 via a gamma-glutamic acid and mini-PEG linker.

    Key Molecular Data

    • Molecular Weight: 4,813.52 Da (free base)
    • Molecular Formula: C225H348N48O68
    • Amino Acid Count: 39 residues (linear)
    • CAS Number: 2023788-19-2
    • Acylation Site: Lys20 (C20 fatty diacid via PEG spacer)
    • Aib Substitution: Position 2 (DPP-IV resistance)
    • Isoelectric Point: ~5.0 (estimated)
    • Sequence: H-YXEGTFTSDYSIYLDKIAQKAFVQWLIAGGPSSGAPPPS-NH2 (X = Aib, K20 acylated)

    Brand Name Context: Mounjaro

    Mounjaro is Eli Lilly and Company's registered brand name for tirzepatide injection. The brand name refers exclusively to the FDA-approved pharmaceutical product, not to research-grade tirzepatide. Eli Lilly also markets tirzepatide under the brand name Zepbound for a separate approved indication. Research-grade tirzepatide sold by peptide vendors is not affiliated with or endorsed by Eli Lilly. ChemVerify verifies vendor-provided certificates of analysis (COAs) for research-grade tirzepatide – it does not test or verify pharmaceutical-grade products.

    ChemVerify does not sell, distribute, or send samples for testing. We independently verify vendor-provided COAs against analytical standards to help researchers assess peptide quality.

    Dual GIP/GLP-1 Receptor Mechanism

    Tirzepatide is structurally unique among incretin-based peptides because it activates both the glucose-dependent insulinotropic polypeptide (GIP) receptor and the glucagon-like peptide-1 (GLP-1) receptor. Its primary sequence is derived from the native 42-amino acid GIP hormone, with modifications engineered for GLP-1 receptor cross-reactivity. Receptor binding studies show tirzepatide binds the GIP receptor with affinity comparable to native GIP, while its GLP-1 receptor affinity is approximately 5-fold lower than native GLP-1 but with biased agonism toward cAMP signaling over β-arrestin recruitment.

    Receptor Binding Comparison

    • GIP receptor: EC50 ~0.02 nM (comparable to native GIP)
    • GLP-1 receptor: EC50 ~0.1 nM (biased agonist – favors Gs/cAMP over β-arrestin)
    • Half-life: ~5 days (116 hours), enabled by C20 fatty diacid albumin binding
    • Native GIP half-life: ~5–7 minutes (rapid DPP-IV cleavage)
    • Native GLP-1 half-life: ~2 minutes (rapid DPP-IV cleavage)

    Chemical Comparison: Tirzepatide vs Semaglutide vs Retatrutide

    The following table compares chemical properties only. No efficacy or health outcome comparisons are made.

    PropertyTirzepatideSemaglutideRetatrutide
    Molecular Weight4,813.52 Da4,113.58 Da~4,605 Da
    Amino Acids393139
    Receptor TargetsGIP + GLP-1 (dual)GLP-1 onlyGIP + GLP-1 + Glucagon (triple)
    Fatty Acid MoietyC20 diacid (eicosanedioic)C18 diacid (octadecanedioic)C20 diacid
    Acylation SiteLys20Lys26Lys17
    DPP-IV ResistanceAib2Aib8Aib2
    Half-life~116 hours (~5 days)~165 hours (~7 days)~6 days (est.)
    CAS Number2023788-19-2910463-68-22381089-83-2
    Parent HormoneGIPGLP-1GIP

    Analytical Methods for Identification

    Accurate identification and purity assessment of research-grade tirzepatide requires multiple orthogonal analytical techniques. Laboratories typically employ reversed-phase HPLC (RP-HPLC) for purity determination, electrospray ionization mass spectrometry (ESI-MS) for intact mass confirmation, and LC-MS/MS peptide mapping for sequence and modification verification. The C20 fatty diacid at Lys20 produces a characteristic mass shift of ~1,118 Da relative to the unmodified peptide backbone.

    • RP-HPLC: C18 column, 0.1% TFA/ACN gradient, 214 nm detection – purity ≥95% for research grade
    • ESI-MS: Expected [M+H]+ ions at m/z 4,814.5 (monoisotopic), multi-charged envelope centered around +4 to +6
    • LC-MS/MS: Tryptic digest peptide mapping confirms sequence and Lys20 acylation
    • Amino Acid Analysis: Quantitative AAA confirms 39-residue composition including Aib
    • Water Content: Karl Fischer titration (lyophilized powder typically <5%)

    Stability Profile & Salt Forms

    Lyophilized tirzepatide demonstrates good long-term stability when stored at -20°C under desiccated conditions. The peptide is typically supplied as the trifluoroacetate (TFA) salt or acetate salt. TFA salt forms generally show higher solubility in aqueous systems but can interfere with certain cell-based assays at concentrations above 0.1%. For sensitive biological assays, acetate salt or TFA-to-acetate salt exchange is recommended.

    Storage Conditions

    • Lyophilized: -20°C, desiccated, protected from light – stable ≥24 months
    • Reconstituted: 2–8°C in sterile buffer – use within 14 days
    • Avoid repeated freeze-thaw cycles (aliquot for multi-use)
    • Aqueous solubility: readily soluble at pH 4–7 in water, PBS, or dilute acetic acid
    • Primary degradation pathway: deamidation at Asn residues, monitored by RP-HPLC

    Frequently Asked Questions

    Is Mounjaro the same as tirzepatide?

    Mounjaro is Eli Lilly's registered brand name for tirzepatide injection, an FDA-approved pharmaceutical product. Research-grade tirzepatide from peptide vendors is not affiliated with Eli Lilly or the Mounjaro brand. The chemical compound (tirzepatide) is the same molecule, but pharmaceutical-grade and research-grade products differ in manufacturing standards, formulation, and regulatory status.

    What does dual GIP/GLP-1 agonist mean in chemical terms?

    A dual agonist binds and activates two distinct G-protein coupled receptors. Tirzepatide's primary sequence is derived from native GIP (giving it high GIP receptor affinity), while specific amino acid substitutions in the mid-chain region confer cross-reactivity with the GLP-1 receptor. This is distinct from co-administering two separate peptides – the dual activity resides in a single 39-amino acid chain.

    How can I distinguish tirzepatide from semaglutide analytically?

    The ~700 Da molecular weight difference (4,813 vs 4,114 Da) is immediately apparent on ESI-MS. RP-HPLC retention times also differ due to the larger C20 vs C18 fatty acid and different peptide backbone hydrophobicity. LC-MS/MS peptide mapping after tryptic digestion produces entirely different fragment ion patterns due to distinct primary sequences (39 AA GIP-based vs 31 AA GLP-1-based).

    What purity should research-grade tirzepatide have?

    Research-grade tirzepatide should demonstrate ≥95% purity by RP-HPLC (area percent at 214 nm). The intact mass by ESI-MS must match the theoretical MW of 4,813.52 ± 2 Da. Common impurities include deamidated variants, truncated sequences, and deacylated (missing C20 fatty diacid) forms. CoAs should report both HPLC purity and MS confirmation.

    How should research-grade tirzepatide be reconstituted?

    Reconstitute lyophilized tirzepatide by adding sterile water or bacteriostatic water slowly down the vial wall. Do not vortex – gently swirl until fully dissolved. Typical reconstitution volumes are 1–2 mL per mg for stock solutions. The peptide dissolves readily at pH 4–7. For long-term storage of reconstituted solutions, aliquot and store at -20°C. Avoid repeated freeze-thaw cycles.

    Compare verified tirzepatide pricing and COA data across vendors at chemverify.com/product/tirzepatide

    Compounds Referenced in This Article

    Explore detailed chemical profiles and research guides for compounds discussed in this article:

    Further Reading on ChemVerify

    • Read more: GLP-1 Receptor Agonist Peptides: Research Compound Analysis → https://www.chemverify.com/learn/weight-loss-peptides-research
    • Read more: Semaglutide vs. Tirzepatide: Molecular Structure & Research Profile → https://www.chemverify.com/learn/semaglutide-vs-tirzepatide
    • Read more: Retatrutide vs. Tirzepatide: Triple vs. Dual Agonist Comparison → https://www.chemverify.com/learn/retatrutide-vs-tirzepatide
    • Read more: Tirzepatide: Complete Research Guide & Chemical Profile → https://www.chemverify.com/learn/tirzepatide

    Compare Verified Vendors

    Browse COA-verified suppliers with exclusive discount codes and transparent pricing.

    Browse Vendors

    You Might Also Like

    Continue Reading

    Related Content