Specialty · 4,032 Da · 32 amino acids
Research Chemical - Not for Human Use
Best price per mg
$10.99/mg
with discount code · market All Markets
- 1
- Vendors
- 0
- Lab tests
- —
- best rating
See the PNC-27 price per mg from 1 vendor, with published certificates of analysis and lab results where available.
Description
PNC-27 – molecular formula C188H293N53O44S, molecular weight 4032 Da, CAS 1159861-00-3. PubChem CID 16201774.
Quick Facts
- Category
- Specialty
- Molecular Weight
- 4,032 Da
- CAS Number
- 1159861-00-3
- Amino Acids
- 32
A CAS number uniquely identifies a chemical substance.
g/mol describes mass per mole; Da describes the mass of a single molecule. A vendor’s mg value is the mass in the offered package.
Amino acids are the building blocks of a peptide; the count gives their number.
Offers
1 vendorfrom $10.99/mg with code
No offers in North America – showing every market instead.
Certificates of analysis for PNC-27
1 vendor publishes third-party certificates of analysis for PNC-27. 1 published report in total. Best reported purity per vendor: 97.27%.
- RC Peptides
Janoshik Analytical · June 25, 2026
97.27%COA from RC Peptides
Known Research Compound Interactions
Based on published preclinical research literature
For laboratory research reference only. Not for human consumption. Interaction data derived from preclinical studies and receptor binding profiles. Always consult primary literature for specific research protocols.
Interaction assessments based on receptor binding affinity, signaling pathway analysis, and published preclinical data. For laboratory research use only. Not for human consumption.
Molecular Information
Sequence, synonyms, structure
Molecular Weight
4,032 Da
Stated Purity
Half-Life
The stated purity is a specification, not a measured result for a particular batch. Check the corresponding analysis report for the measured value.
Amino Acid Sequence
PPLSQETFSDLWKLLKKWKMRRNQFWVKVQRGFor laboratory research use only. Not for human consumption.